PTM Viewer PTM Viewer

AT3G03410.1

Arabidopsis thaliana [ath]

EF hand calcium-binding protein family

No PTMs currently found

PLAZA: AT3G03410
Gene Family: HOM05D000135
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 131

MSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKMLKEVFVFCDVDGDGKIPASESYVTMTSLGKKFTEETSAEKVRAADVDGDGYLNFDEFMALVIGDI

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 1 131
Sites
Show Type Position
Active Site 11
Active Site 13
Active Site 15
Active Site 17
Active Site 22
Active Site 47
Active Site 49
Active Site 51
Active Site 53
Active Site 58
Active Site 111
Active Site 113
Active Site 115
Active Site 117
Active Site 122

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here